Loading...
Statistics
Advertisement

The Pizza Shack 705-745-7422
www.thepizzashack.ca/
The Pizza Shack Menu Peterborough 705-745-7422.

Thepizzashack.ca

Advertisement
Conversion Technology Metas Server
Thepizzashack.ca is hosted in Canada / Parksville . Thepizzashack.ca uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Thepizzashack.ca

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

CDN

Number of occurences: 1
  • CloudFlare

Social

Number of occurences: 1
  • Twitter Button

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thepizzashack.ca

SSL certificate

    • name: /CN=*.bravehost.com
    • subject:
      • CN: *.bravehost.com
    • hash: dae5ecaa
    • issuer:
      • C: US
      • O: GeoTrust Inc.
      • CN: RapidSSL SHA256 CA - G3
    • version: 2
    • serialNumber: 552724
    • validFrom: 151119020648Z
    • validTo: 170120143635Z
    • validFrom_time_t: 1447898808
    • validTo_time_t: 1484922995
    • extensions:
      • authorityKeyIdentifier: keyid:C3:9C:F3:FC:D3:46:08:34:BB:CE:46:7F:A0:7C:5B:F3:E2:08:CB:59
      • authorityInfoAccess: OCSP - URI:http://gv.symcd.com CA Issuers - URI:http://gv.symcb.com/gv.crt
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • subjectAltName: DNS:*.bravehost.com, DNS:bravehost.com
      • crlDistributionPoints: Full Name: URI:http://gv.symcb.com/gv.crl
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.rapidssl.com/legal

Meta - Thepizzashack.ca

Number of occurences: 3
  • Name:
    Content:
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: description
    Content: The Pizza Shack Menu Peterborough 705-745-7422.

Server / Hosting

  • IP: 69.90.193.74
  • Latitude: 49.32
  • Longitude: -124.32
  • Country: Canada
  • City: Parksville

Rname

  • ns11.bravehost.com
  • ns12.bravehost.com
  • mail1.bravehost.com
  • mail2.bravehost.com

Target

  • dnsadmin.bravenet.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 11 Sep 2016 08:11:42 GMT Server: Apache Last-Modified: Sat, 17 Oct 2015 12:25:44 GMT ETag: "616eb101-d5a-5224c02d62200" Accept-Ranges: bytes Content-Length: 3418 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_wx1123 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

DNS

host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 69.90.193.74
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns11.bravehost.com
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns12.bravehost.com
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns11.bravehost.com
  5. rname: dnsadmin.bravenet.com
  6. serial: 2008013001
  7. refresh: 28800
  8. retry: 7200
  9. expire: 1209600
  10. minimum-ttl: 3600
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mail1.bravehost.com
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 20
  5. target: mail2.bravehost.com
host: thepizzashack.ca
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 include:spf1.bravehost.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hepizzashack.ca, www.tqhepizzashack.ca, www.qhepizzashack.ca, www.tahepizzashack.ca, www.ahepizzashack.ca, www.t hepizzashack.ca, www. hepizzashack.ca, www.twhepizzashack.ca, www.whepizzashack.ca, www.tehepizzashack.ca, www.ehepizzashack.ca, www.tzhepizzashack.ca, www.zhepizzashack.ca, www.txhepizzashack.ca, www.xhepizzashack.ca, www.tchepizzashack.ca, www.chepizzashack.ca, www.tepizzashack.ca, www.theepizzashack.ca, www.teepizzashack.ca, www.thdepizzashack.ca, www.tdepizzashack.ca, www.thcepizzashack.ca, www.tcepizzashack.ca, www.thuepizzashack.ca, www.tuepizzashack.ca, www.thjepizzashack.ca, www.tjepizzashack.ca, www.thepizzashack.ca, www.tepizzashack.ca, www.thbepizzashack.ca, www.tbepizzashack.ca, www.thgepizzashack.ca, www.tgepizzashack.ca, www.thpizzashack.ca, www.thexpizzashack.ca, www.thxpizzashack.ca, www.thespizzashack.ca, www.thspizzashack.ca, www.thewpizzashack.ca, www.thwpizzashack.ca, www.therpizzashack.ca, www.thrpizzashack.ca, www.thefpizzashack.ca, www.thfpizzashack.ca, www.thevpizzashack.ca, www.thvpizzashack.ca, www.thecpizzashack.ca, www.thcpizzashack.ca, www.theqpizzashack.ca, www.thqpizzashack.ca, www.theapizzashack.ca, www.thapizzashack.ca, www.theypizzashack.ca, www.thypizzashack.ca, www.theizzashack.ca, www.thepiizzashack.ca, www.theiizzashack.ca, www.thepkizzashack.ca, www.thekizzashack.ca, www.thepuizzashack.ca, www.theuizzashack.ca, www.theplizzashack.ca, www.thelizzashack.ca, www.thepzzashack.ca, www.thepirzzashack.ca, www.theprzzashack.ca, www.thepifzzashack.ca, www.thepfzzashack.ca, www.thepivzzashack.ca, www.thepvzzashack.ca, www.thepikzzashack.ca, www.thepkzzashack.ca, www.thepi,zzashack.ca, www.thep,zzashack.ca, www.thepibzzashack.ca, www.thepbzzashack.ca, www.thepigzzashack.ca, www.thepgzzashack.ca, www.thepitzzashack.ca, www.theptzzashack.ca, www.thepiyzzashack.ca, www.thepyzzashack.ca, www.thepiuzzashack.ca, www.thepuzzashack.ca, www.thepijzzashack.ca, www.thepjzzashack.ca, www.thepimzzashack.ca, www.thepmzzashack.ca, www.thepinzzashack.ca, www.thepnzzashack.ca, www.thepizashack.ca, www.thepiztzashack.ca, www.thepitzashack.ca, www.thepizazashack.ca, www.thepiazashack.ca, www.thepizszashack.ca, www.thepiszashack.ca, www.thepizxzashack.ca, www.thepixzashack.ca, www.thepizczashack.ca, www.thepiczashack.ca, www.thepizgzashack.ca, www.thepigzashack.ca, www.thepizhzashack.ca, www.thepihzashack.ca, www.thepizjzashack.ca, www.thepijzashack.ca, www.thepizuzashack.ca, www.thepiuzashack.ca, www.thepizashack.ca, www.thepizztashack.ca, www.thepiztashack.ca, www.thepizzaashack.ca, www.thepizaashack.ca, www.thepizzsashack.ca, www.thepizsashack.ca, www.thepizzxashack.ca, www.thepizxashack.ca, www.thepizzcashack.ca, www.thepizcashack.ca, www.thepizzgashack.ca, www.thepizgashack.ca, www.thepizzhashack.ca, www.thepizhashack.ca, www.thepizzjashack.ca, www.thepizjashack.ca, www.thepizzuashack.ca, www.thepizuashack.ca, www.thepizzshack.ca, www.thepizzaoshack.ca, www.thepizzoshack.ca, www.thepizzapshack.ca, www.thepizzpshack.ca, www.thepizza9shack.ca, www.thepizz9shack.ca, www.thepizzashack.ca, www.thepizzshack.ca, www.thepizzaishack.ca, www.thepizzishack.ca, www.thepizzaushack.ca, www.thepizzushack.ca, www.thepizzahack.ca, www.thepizzasehack.ca, www.thepizzaehack.ca, www.thepizzaswhack.ca, www.thepizzawhack.ca, www.thepizzasdhack.ca, www.thepizzadhack.ca, www.thepizzasxhack.ca, www.thepizzaxhack.ca, www.thepizzasfhack.ca, www.thepizzafhack.ca, www.thepizzasghack.ca, www.thepizzaghack.ca, www.thepizzasthack.ca, www.thepizzathack.ca, www.thepizzasack.ca, www.thepizzasheack.ca, www.thepizzaseack.ca, www.thepizzashdack.ca, www.thepizzasdack.ca, www.thepizzashcack.ca, www.thepizzascack.ca, www.thepizzashuack.ca, www.thepizzasuack.ca, www.thepizzashjack.ca, www.thepizzasjack.ca, www.thepizzashack.ca, www.thepizzasack.ca, www.thepizzashback.ca, www.thepizzasback.ca, www.thepizzashgack.ca, www.thepizzasgack.ca,

Other websites we recently analyzed

  1. À岩
    Shanghai (China) - 222.73.144.185
    Server software: Nginx
    Technology: CSS, Html, Iframe, Swf Object
    Number of meta tags: 1
  2. zyprian photographie | Das mobile Fotostudio – Events – Werbung – Hochzeiten
    Germany - 82.165.196.138
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
    Number of Javascript: 5
    Number of meta tags: 3
  3. Trigrid Internship
    Scottsdale (United States) - 50.63.97.128
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  4. christsmercychurch.com
    The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
    New York (United States) - 198.185.159.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  5. smallkitchenappliancesreview.com
    Virgin Islands, British - 208.91.197.13
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  6. Bellingham Dental Group – Dentist in Bellingham, WA - Dentist Bellingham WA with Dr. Parker Haley
    Bellingham Dentist Dr. Parker Haley leads Bellingham Dental Group, offering a range of dental services including student & emergency services. 360-734-6190
    Scottsdale (United States) - 50.62.89.138
    G Analytics ID: UA-42878548-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Google +1 Button
    Number of Javascript: 13
    Number of meta tags: 5
  7. Home
    My Joomla CMS
    Australia - 221.121.144.145
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, SuperFish, Joomla
    Number of Javascript: 15
    Number of meta tags: 3
  8. ylvx.net
    Ottawa (Canada) - 47.90.20.17
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  9. beorc.com
    Wayne (United States) - 74.208.84.115
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  10. Changeist: Futures, Innovation, Strategic Design
    Changeist is a post-national research, consulting and creative group focused on strategic innovation for the future.
    New York (United States) - 198.49.23.145
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7

Check Other Websites